Protein coding transcript 254752

• Transcript: Ll_transcript_34422
• CDS coordinates: 226-1440 (+)
• Peptide sequence: MDSARSWLQKFQPRDKMRATSRKNDDSNGGNEDSNEPLDEAALSNITKQKVAAAKQYIENHYKEQMKSLQERKERRTILEKKLADADVSEEDQNNLLKFLEKKETEYMRLQRHKMGVDDFELLTMIGKGAFGEVRVCREKTTDHVYAMKKLKKSEMLRRGQVEHVRAERNLLAEVDSNCIVKLYCSFQDDEYLYLIMEYLPGGDMMTLLMRKDTLDEDEARFYVGETVLAIESIHKHNYIHRDIKPDNLLLDRYGHLRLSDFGLCKPLDCSTLEESDFTPSQNANASPQNDEHGTPKRTQQEQLDNWQKNRRTLAYSTVGTPDYIAPEVLLKKGYGMECDWWSLGAIMYEMLVGYPPFYSDEPMTTCRKIVNWQSHLKFPVEARLSLEAKDLISKLLCNVSHRLG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_34422

• Blastp: Serine/threonine-protein kinase tricorner from Sophophora with 53.35% of identity
• Blastx: Serine/threonine-protein kinase tricorner from Sophophora with 53.35% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (Dpse_GA21227)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455458.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;