Protein coding transcript 254753

• Transcript: Ll_transcript_34423
• CDS coordinates: 232-1263 (+)
• Peptide sequence: MASARSWLQRLQPRDKMRAGSKKREEDSDSNNNRGNGDSNAPVDEVTKQKVAAAKQYIENHYKEQMKNLQERKERRAVLENKLADADVSEEDQNNLFKFLEKKETEYMRLKRHKMGAGNFELLTMIGKGAFGEVRVCREKTTGHVYAMKKLKKSEMLRRGQVEHVISERNLLAEVDSNCIVKLYCSFQDEEYLYLIMEYLPGGDMMTLLMRKDTLTEDEARFYVGETVLAIESIHKRNYIHRDIKPDNLLLDRYGHLRLSDFGLCKPLDCRTLEEKDFSMGQNVNGTRFTRNDEHAAPKRTQQEQLQHWQQNRRTLAYSTVGTPDYIAPEVLLKKGYGMECDW*
• ORF Type: complete

Annotations of Ll_transcript_34423

• Blastp: Serine/threonine-protein kinase tricorner from Sophophora with 51.54% of identity
• Blastx: Serine/threonine-protein kinase tricorner from Sophophora with 52.82% of identity
• Eggnog: serine threonine-protein kinase(ENOG410XQC0)
• Kegg: Link to kegg annotations (Dmel_CG8637)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433044.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;