Protein coding transcript 254756

• Transcript: Ll_transcript_34428
• CDS coordinates: 232-1233 (+)
• Peptide sequence: MASARSWLQRLQPRDKMRAGSKKREEDSDSNNNRGNGDSNAPVDEVTKQKVAAAKQYIENHYKEQMKNLQERKERRAVLENKLADADVSEEDQNNLFKFLEKKETEYMRLKRHKMGAGNFELLTMIGKGAFGEVRVCREKTTGHVYAMKKLKKSEMLRRGQVEHVISERNLLAEVDSNCIVKLYCSFQDEEYLYLIMEYLPGGDMMTLLMRKDTLTEDEARFYVGETVLAIESIHKRNYIHRDIKPDNLLLDRYGHLRLSDFGLCKPLDCSTLEESDFSSGQNANGSAQNDESVPPKRTQQEQLENWQKNRRTLAYSTVGTPDYIAPEVLLKKG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_34428

• Blastp: Probable serine/threonine-protein kinase ndrA from Dictyostelium with 48.59% of identity
• Blastx: Probable serine/threonine-protein kinase ndrA from Dictyostelium with 51.01% of identity
• Eggnog: serine threonine-protein kinase(ENOG410XQC0)
• Kegg: Link to kegg annotations (DDB_G0278457)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433044.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;