| Transcript | Ll_transcript_36273 |
|---|---|
| CDS coordinates | 1-324 (+) |
| Peptide sequence | GVPMVAWPLYAEQKLNRVVLVKEMKVGLALKECEDGFVNATELGEHVKELMNSEKGKEIRERILNMKVSAVEARAEGGSSYGALNRMTKTWEEKEHLHHFSPNGIFT* |
| ORF Type | 5prime_partial |
| Blastp | UDP-glycosyltransferase 1 from Pueraria with 66.67% of identity |
|---|---|
| Blastx | Isoflavone 7-O-glucosyltransferase 1 from Soja with 64.89% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019449720.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer