Transcript | Ll_transcript_36276 |
---|---|
CDS coordinates | 1-324 (+) |
Peptide sequence | GVPMVAWPLYAEQKLNRVVLVKEMKVGLALKECEDGFVNATELGEHVKELMNSEKGKEIRERILNMKVSAVEARAEGGSSYGALNRMTKTWEEKEHLHHFSPNGIFT* |
ORF Type | 5prime_partial |
Blastp | UDP-glycosyltransferase 1 from Pueraria with 66.67% of identity |
---|---|
Blastx | Isoflavone 7-O-glucosyltransferase 1 from Soja with 64.89% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449720.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer