Protein coding transcript 254886

• Transcript: Ll_transcript_34354
• CDS coordinates: 522-1382 (+)
• Peptide sequence: MKFFSLLVLSLSFFSVTGQLPSRDVLALLEFKKGIRLDPTGYVLSSWNEESIDFDGCPSSWNGVLCNGGNVAGVVLDNLGLSADADLSVFSNLTKLVKLSMSNNSISGKLPDNIGDFKSLQFLDISNNLFSSSLPPGIGNLGSLQNLSLAGNNFSGLIPDTISKMASIQSLDLSRNSFSGALRASLTKLKSLVSLDLSNNGLTGKIPEGFELMPSLEKLDLHGNMLDGHLDAEFILLSSASYVDFSDNRLVSSDFQRQKFLPRISESIKHLNLSHNLLTGTLVSGAE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_34354

• Blastp: Probable LRR receptor-like serine/threonine-protein kinase At4g20940 from Arabidopsis with 70.15% of identity
• Blastx: Probable LRR receptor-like serine/threonine-protein kinase At4g20940 from Arabidopsis with 69.63% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT4G20940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420041.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;