| Transcript | Ll_transcript_34728 |
|---|---|
| CDS coordinates | 969-1361 (+) |
| Peptide sequence | MCNVIVCYKTLIHHRWSKIAKHLPGRTDNEIKNFWRTRIQKHIKQAENFQQQCTSDKTNDNNHNHHSTSQMSTNMAHHEPMGTTYSSPSYQGATMDPIFPTQFTPLIPDQPTCCPTNDNTYWSMEDIWTI* |
| ORF Type | complete |
| Blastp | Myb-related protein 340 from Antirrhinum with 46.67% of identity |
|---|---|
| Blastx | Transcription factor MYB57 from Arabidopsis with 34.56% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019427188.1) |
| Pfam | Myb-like DNA-binding domain (PF00249.30) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer