Protein coding transcript 254998

• Transcript: Ll_transcript_33930
• CDS coordinates: 2-595 (+)
• Peptide sequence: ATNVLLDKDLSPKISDFGLAKLNEDGHTHMTTRVAGTYGYMAPEYAMHGYLTDKADVYSFGIVALEIVSGKSNTKSWPKEECFSLVDWVLLLKENGDLMDLVDERLGADFKKEEVMVMINVALHCTHSSPMHRPAMSSVVSMLEGNCDVQEVVPDTEIFDDKKLEAMRHYYQQREKRNICYGSYYALLHMYCNSLYY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_33930

• Blastp: Probable LRR receptor-like serine/threonine-protein kinase At1g07650 from Arabidopsis with 57.84% of identity
• Blastx: Probable LRR receptor-like serine/threonine-protein kinase At1g07650 from Arabidopsis with 57.84% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT1G07650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443851.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;