Protein coding transcript 255

• Transcript: Ll_transcript_366977
• CDS coordinates: 425-1009 (+)
• Peptide sequence: MASSSPNVSPIFFIIFSLFLLISCCKGFEFVVGGNKDQWKVPLQSPDSLNRWAEAQRFRIGDTLVFKYDNSTESVHLVNEEDYLACKTLGNHTILKDGHSKFHLMNSGPFHFISGSQGHCQMGLKLVVVVMSPRPAANGTLLSPPISLALPSPGPSALSPSTNQAVPYTSGTEFISVIMGLGSFIGYMIIFELM*
• ORF Type: complete

Annotations of Ll_transcript_366977

• Blastp: Early nodulin-55-2 from Soja with 45.11% of identity
• Blastx: Early nodulin-55-2 from Soja with 42.93% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (100101855)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453501.1)
• Pfam: Plastocyanin-like domain (PF02298.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;