Transcript | Ll_transcript_33933 |
---|---|
CDS coordinates | 3-797 (+) |
Peptide sequence | SDMGAATFRQTGTNWAVMTSGHFLDSGRSDYYKWSNTTKLAMDNAELYMDARVSPNSLTYYGFCMGNGNYTVNLHFAEIMFTDDKTYSSLGRRVFDIYIQRKLVVKDFNIAKEAAGFNKAVIKNFTAVVTSKALEIRLYWAGKGTTSIPFGSVYGPLISAISVHSDFTPPSEKGSSISVGVVVAIVAAGVIIIILVFGILWWKGCLGQKRSVAGALKGLDNNSGLFTLRQIKAATNNFDRTFKIGEGGFGPVYKVYSAQPNTSA* |
ORF Type | 5prime_partial |
Blastp | Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 from Arabidopsis with 53.39% of identity |
---|---|
Blastx | Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 from Arabidopsis with 59.7% of identity |
Eggnog | leucine Rich Repeat(COG4886) |
Kegg | Link to kegg annotations (AT3G14840) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449221.1) |
Pfam | Di-glucose binding within endoplasmic reticulum (PF11721.7) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer