Protein coding transcript 255005

• Transcript: Ll_transcript_33935
• CDS coordinates: 3-779 (+)
• Peptide sequence: SDMGAATFRQTGTNWAVMTSGHFLDSGRSDYYKWSNTTKLAMDNAELYMDARVSPNSLTYYGFCMGNGNYTVNLHFAEIMFTDDKTYSSLGRRVFDIYIQRKLVVKDFNIAKEAAGFNKAVIKNFTAVVTSKALEIRLYWAGKGTTSIPFGSVYGPLISAISVHSDFTPPSEKGSSISVGVVVAIVAAGVIIIILVFGILWWKGCLGQKRSVAGALKGLDNNSGLFTLRQIKAATNNFDRTFKIGEGGFGPVYKNSSS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_33935

• Blastp: Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 from Arabidopsis with 53.39% of identity
• Blastx: Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 from Arabidopsis with 71.67% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT3G14840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449221.1)
• Pfam: Di-glucose binding within endoplasmic reticulum (PF11721.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;