Protein coding transcript 255012

• Transcript: Ll_transcript_33921
• CDS coordinates: 3-377 (+)
• Peptide sequence: SDMGAATFRQTGTNWAVMTSGHFLDSGRSDYYKWSNTTKLAMDNAELYMDARVSPNSLTYYGFCMGNGNYTVNLHFAEIMFTADKTYSSLGRRVFDIYIQRKLVVKDFNIAKEAGGFDKAIIQNF
• ORF Type: internal

Annotations of Ll_transcript_33921

• Blastp: Probable LRR receptor-like serine/threonine-protein kinase At1g07650 from Arabidopsis with 54.31% of identity
• Blastx: Probable LRR receptor-like serine/threonine-protein kinase At1g07650 from Arabidopsis with 54.31% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT1G07650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449222.1)
• Pfam: Di-glucose binding within endoplasmic reticulum (PF11721.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;