Protein coding transcript 255022

• Transcript: Ll_transcript_33770
• CDS coordinates: 538-1407 (+)
• Peptide sequence: MKDCWFLDNNFNGLSDGIFDDVVEFFDFPIEDVETDVVEEDWAAQFKRLEEPSVGVFSVSSFGLCDTTQDLTPKLGAGSTSSASLEKTAGPTYGKTTPNQNVSFNSQDVHKFRTYSPISVFESSSSSSVENSNFDLPVIPLKRPRGKRLRLSSFNQLLSLPFISHSPDFETQTSGKLKTTVKRQRKKDLLLPPDHSEMKRSSSQESDVFGKCTHCQVTETPQWREGPMGPKTLCNACGVRYRSGRLFPEYRPAASPTFVASLHSNSHKKVIEMRSRAVKKTIRGSVFSL*
• ORF Type: complete

Annotations of Ll_transcript_33770

• Blastp: GATA transcription factor 11 from Arabidopsis with 39.01% of identity
• Blastx: GATA transcription factor 8 from Arabidopsis with 76.32% of identity
• Eggnog: Transcription factor(COG5641)
• Kegg: Link to kegg annotations (AT1G08010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453952.1)
• Pfam: GATA zinc finger (PF00320.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;