Transcript | Ll_transcript_33564 |
---|---|
CDS coordinates | 3-632 (+) |
Peptide sequence | LKMRNLLQEFLKKHDGVRYPSILGLREHIFTGSVSSLAWFMSNQETSFVTIGQRLLANPLRVRFHYGHPDVFDRLFHLTRGGVSKASRVINLSEDIFAGFNSTLREGNVTHHEYIQVGKGRDVGLNQISMFEAKIANGNGEQTLSRDVYRLGHRFDFFRMLSCYFTTVGFYFSTLITVLTVYIFLYGRLYLVLSGLEEGLSTQKAIRDNK |
ORF Type | internal |
Blastp | Callose synthase 3 from Arabidopsis with 96.65% of identity |
---|---|
Blastx | Callose synthase 3 from Arabidopsis with 96.65% of identity |
Eggnog | synthase(ENOG410XQ8V) |
Kegg | Link to kegg annotations (AT5G13000) |
CantataDB | Link to cantataDB annotations (CNT0002450) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019429555.1) |
Pfam | 1,3-beta-glucan synthase component (PF02364.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer