Protein coding transcript 255040

• Transcript: Ll_transcript_33564
• CDS coordinates: 3-632 (+)
• Peptide sequence: LKMRNLLQEFLKKHDGVRYPSILGLREHIFTGSVSSLAWFMSNQETSFVTIGQRLLANPLRVRFHYGHPDVFDRLFHLTRGGVSKASRVINLSEDIFAGFNSTLREGNVTHHEYIQVGKGRDVGLNQISMFEAKIANGNGEQTLSRDVYRLGHRFDFFRMLSCYFTTVGFYFSTLITVLTVYIFLYGRLYLVLSGLEEGLSTQKAIRDNK
• ORF Type: internal

Annotations of Ll_transcript_33564

• Blastp: Callose synthase 3 from Arabidopsis with 96.65% of identity
• Blastx: Callose synthase 3 from Arabidopsis with 96.65% of identity
• Eggnog: synthase(ENOG410XQ8V)
• Kegg: Link to kegg annotations (AT5G13000)
• CantataDB: Link to cantataDB annotations (CNT0002450)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429555.1)
• Pfam: 1,3-beta-glucan synthase component (PF02364.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;