Protein coding transcript 255041

• Transcript: Ll_transcript_33568
• CDS coordinates: 85-594 (+)
• Peptide sequence: MSNQETSFVTIGQRLLANPLRVRFHYGHPDVFDRIFHLTRGGVSKASKVINLSEDIFAGFNSTLREGNVTHHEYIQVGKGRDVGLNQISMFEAKIANGNGEQTLSRDVYRLGHRFDFFRMLSCYFTTIGFYFSTLITVLTVYVFLYGRLYLVLSGLEEGLSTQKAIRDNK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_33568

• Blastp: Callose synthase 3 from Arabidopsis with 95.86% of identity
• Blastx: Callose synthase 3 from Arabidopsis with 95.94% of identity
• Eggnog: synthase(ENOG410XQ8V)
• Kegg: Link to kegg annotations (AT5G13000)
• CantataDB: Link to cantataDB annotations (CNT0002373)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003592817.2)
• Pfam: 1,3-beta-glucan synthase component (PF02364.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;