Protein coding transcript 255161

• Transcript: Ll_transcript_33670
• CDS coordinates: 2481-3137 (+)
• Peptide sequence: MAKILRSDDLPSCSSSPARMQGTFGYFAPEYAIVGRASLESDVFSFGVVLLELISGRHPIHKSMGKEESLVIWAVPRLRDSRRVIMELVDPKLNGNFQEEEVQIMAYLAKECLLLDPDTRPTMSEVVQVLCSISPGKSWSRRKISANLFQEHDDTEKQRQVHSSLTLDINHKIKEAAEHEDNFLLTSKDECWHASEEEIVDLTEPRFESFCMTNTHSP*
• ORF Type: complete

Annotations of Ll_transcript_33670

• Blastp: Receptor-like serine/threonine-protein kinase NCRK from Arabidopsis with 57.14% of identity
• Blastx: Receptor-like serine/threonine-protein kinase NCRK from Arabidopsis with 60.92% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT2G28250)
• CantataDB: Link to cantataDB annotations (CNT0000711)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448748.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;