| Transcript | Ll_transcript_339669 |
|---|---|
| CDS coordinates | 3-332 (+) |
| Peptide sequence | WDPKYTHFGINVNTIESSADVKWDRVEGAIGTARMDYNAGTKNLTVVSSYPGTEVYYTVSYVVDLRNVLPEWVRVGLTGASGGCVEVHSIQVWYFSSSLQYTNNANNNKE |
| ORF Type | internal |
| Blastp | Agglutinin-2 from Cladrastis with 56.86% of identity |
|---|---|
| Blastx | Agglutinin-2 from Cladrastis with 56.86% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019447355.1) |
| Pfam | Legume lectin domain (PF00139.18) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer