Protein coding transcript 255332

• Transcript: Ll_transcript_34285
• CDS coordinates: 2-343 (+)
• Peptide sequence: FLLLSYGCQRSSQCPMCWQAFNLKDPTRTCRFQCVICIYRWLTIVGLRVIWMYLWLKLQVLNKVEGENMDYSNKTTIFNNKSRMRAFIQFVTDHKQQPQVFQEAPILPDLPMP*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_34285

• Blastp: E3 ubiquitin-protein ligase RHF2A from Arabidopsis with 85% of identity
• Blastx: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 from Arabidopsis with 62.75% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT5G22000)
• CantataDB: Link to cantataDB annotations (CNT0002181)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449030.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;