Protein coding transcript 2554

• Transcript: Ll_transcript_281110
• CDS coordinates: 1-330 (+)
• Peptide sequence: HEGVGVVEELGPNCTILKKGDRVGWGYEHDSCRHCQECLRGNETFCAKREMYGMADLDQGSMAEGAVWSEAFLFKIPDSMSDEIAAPLMCGGATVFNALHMYGVKPTEVV
• ORF Type: internal

Annotations of Ll_transcript_281110

• Blastp: Alcohol dehydrogenase from Geobacillus with 45.37% of identity
• Blastx: Alcohol dehydrogenase from Geobacillus with 45.37% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016201082.1)
• Pfam: Alcohol dehydrogenase GroES-like domain (PF08240.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;