Protein coding transcript 255421

• Transcript: Ll_transcript_35790
• CDS coordinates: 141-608 (+)
• Peptide sequence: MDPMDIVGKSKEDASLPKATMTKIIKEMLPPDVRVARDTQDILIECCVEFINLLSSESNEVCSKEERRTIAPEHVLKALGGLGFGDYIEEVYSAYEQHKVETMDSLKGAKLSNRAEMTEEEALAEQQRMFAEARARMNGGAIASKQPDADQSFES*
• ORF Type: complete

Annotations of Ll_transcript_35790

• Blastp: Protein Dr1 homolog from Arabidopsis with 77.92% of identity
• Blastx: Protein Dr1 homolog from Arabidopsis with 77.92% of identity
• Eggnog: Down-regulator of transcription 1, TBP-binding (Negative cofactor 2)(COG5150)
• Kegg: Link to kegg annotations (AT5G23090)
• CantataDB: Link to cantataDB annotations (CNT0002891)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417433.1)
• Pfam: Histone-like transcription factor (CBF/NF-Y) and archaeal histone (PF00808.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;