Protein coding transcript 255428

• Transcript: Ll_transcript_35779
• CDS coordinates: 1-306 (-)
• Peptide sequence: MTKIIKEMLPPDVRVARDTQDLLIECCIEFINLLSSESNEVCSKEERRTIAPEHVLKALGGLGFGDYIEEVYSAYEQHKVETMDSLKGAKWSNRAEMTEEEA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_35779

• Blastp: Protein Dr1 homolog from Arabidopsis with 78.64% of identity
• Blastx: Protein Dr1 homolog from Arabidopsis with 80% of identity
• Eggnog: Down-regulator of transcription 1, TBP-binding (Negative cofactor 2)(COG5150)
• Kegg: Link to kegg annotations (AT5G23090)
• CantataDB: Link to cantataDB annotations (CNT0002891)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437094.1)
• Pfam: Histone-like transcription factor (CBF/NF-Y) and archaeal histone (PF00808.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;