Protein coding transcript 255431

• Transcript: Ll_transcript_33321
• CDS coordinates: 2-382 (+)
• Peptide sequence: LHRQEIHQISRWWTELGLGNELKYARNQPLQWYMCSLACLSDPTLSEERVELTKAISFIYILDDTFDLHGTLHEFTIFTDVVSGWHIAASEQLPDCMKICFKALYNLNNEINTKIYRKHGFNPTQR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_33321

• Blastp: (3S,6E)-nerolidol synthase 1 from Fragaria with 61.6% of identity
• Blastx: (3S,6E)-nerolidol synthase 1 from Fragaria with 61.6% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426257.1)
• Pfam: Terpene synthase family, metal binding domain (PF03936.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;