Transcript | Ll_transcript_35218 |
---|---|
CDS coordinates | 289-774 (+) |
Peptide sequence | MAVAENVGTKIGSSSQNLDNSVVSSDTTVEVEKSKPRNGSINGGDENMNGVFNHHFRAPNGNYKVQMGQIRNGFEGNGVQNQHMVVNNNGYGGVNGENGGESFKRDMRDLEELLSKLNPMAEEFVPPSLINNFGYLAAYDAGFGYPNNFVLPNNYGIVNGQN |
ORF Type | 3prime_partial |
Blastp | Polyadenylate-binding protein-interacting protein 10 from Arabidopsis with 33.99% of identity |
---|---|
Blastx | Polyadenylate-binding protein-interacting protein 10 from Arabidopsis with 32.03% of identity |
Eggnog | Rna-binding protein(COG0724) |
Kegg | Link to kegg annotations (AT3G49390) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437323.1) |
Pfam | Ataxin-2 C-terminal region (PF07145.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer