Protein coding transcript 255627

• Transcript: Ll_transcript_36008
• CDS coordinates: 1090-1629 (-)
• Peptide sequence: MERYKARLVAKGFTQKERIDYKETFSLVSSKDSLRTIMALVAHYDLKLHPMDVKTTFLNGNIDEKIYMVQPENFIMGDQKNMVCKLTKSIYGLMQASRQWYHKFHEVILSFSFEMTSVKDCVYHKFSGSKYIFLLLYVDDILLTTNDVGTLLETRKFLSSNFELKDLGEASFVLGIQIH*
• ORF Type: complete

Annotations of Ll_transcript_36008

• Blastp: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 50.85% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 45.65% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020997393.1)
• Pfam: Reverse transcriptase (RNA-dependent DNA polymerase) (PF07727.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;