Protein coding transcript 255630

• Transcript: Ll_transcript_33879
• CDS coordinates: 3-302 (+)
• Peptide sequence: YRAPDKDMLFSKSSSTVPSRGAVDFASAVEKLATQDSGIWKYDKNGFGDVAIGSSRSSHVLASGYYGGHGRADFGDRLQSRGSARAAPVWLETGDTVGK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_33879

• Blastp: Polyadenylate-binding protein-interacting protein 7 from Arabidopsis with 53% of identity
• Blastx: Polyadenylate-binding protein-interacting protein 7 from Arabidopsis with 48.65% of identity
• Eggnog: smr domain containing protein(ENOG4111EZQ)
• Kegg: Link to kegg annotations (AT2G26280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414983.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;