| Transcript | Ll_transcript_521747 |
|---|---|
| CDS coordinates | 588-947 (+) |
| Peptide sequence | MESKRRDLAVLEANDGVWPGVKIPSYALFLWASGTELTTILEQDQINHMPNKYIPRDLRKKLAEIIPGLRPWEVLSMEQAMDQITFNGEWYREPLGSYTTGPPYIQHWNEDVLRLYKIYE |
| ORF Type | 3prime_partial |
| Blastp | Protein TIC 56, chloroplastic from Arabidopsis with 71.43% of identity |
|---|---|
| Blastx | Protein TIC 56, chloroplastic from Arabidopsis with 75.32% of identity |
| Eggnog | NA(ENOG4111F7B) |
| Kegg | Link to kegg annotations (AT5G01590) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019446533.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer