Protein coding transcript 255672

• Transcript: Ll_transcript_50118
• CDS coordinates: 542-1177 (+)
• Peptide sequence: MSSFIRVNHKNLRTIYMTSLSQNKFGVRTIRYSPDEMMAALYLQVSIISQALIFVTRSRSWSFAERPGLLLLGAFLIAQLVATFIAVYANWEFARIKGMGWGWAGVIWLYSLVTYIPLDLLKFAIRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNEKNSYRELSEIAEQAKRRAEVARLRELHTLKGH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_50118

• Blastp: Plasma membrane ATPase 4 from Nicotiana with 81.82% of identity
• Blastx: ATPase 9, plasma membrane-type from Arabidopsis with 75.9% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438801.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;