Protein coding transcript 255675

• Transcript: Ll_transcript_50123
• CDS coordinates: 554-961 (+)
• Peptide sequence: MGWGWAGVIWLYSLVTYIPLDLLKFAIRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNEKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV*
• ORF Type: complete

Annotations of Ll_transcript_50123

• Blastp: Plasma membrane ATPase 4 from Nicotiana with 90.3% of identity
• Blastx: Plasma membrane ATPase 4 from Nicotiana with 74.61% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0001630)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447351.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;