Protein coding transcript 255676

• Transcript: Ll_transcript_50125
• CDS coordinates: 269-991 (+)
• Peptide sequence: MTISKDRVKPSPLPDSWKLREIFATGVVLGSYMALMTVVFFWVMKDTNFFPNKFGVRTIRYSPDEMMAALYLQVSIISQALIFVTRSRSWSFAERPGLLLLGAFLIAQLVATFIAVYANWEFARIKGMGWGWAGVIWLYSLVTYIPLDLLKFAIRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNEKNSYRELSEIAEQAKRRAEVARLRELHTLKGH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_50125

• Blastp: Plasma membrane ATPase 4 from Nicotiana with 84.65% of identity
• Blastx: Plasma membrane ATPase 4 from Nicotiana with 82.87% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447351.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;