| Transcript | Ll_transcript_50127 |
|---|---|
| CDS coordinates | 3-458 (+) |
| Peptide sequence | TFLAVYANWSFARIKGMGWGWAGVIWLYSLVTYVPLDILKFAIRYALSGKAWNNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETTNIFNDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV* |
| ORF Type | 5prime_partial |
| Blastp | Plasma membrane ATPase 4 from Nicotiana with 88.08% of identity |
|---|---|
| Blastx | Plasma membrane ATPase 4 from Nicotiana with 88.08% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | Link to cantataDB annotations (CNT0001630) |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019438351.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer