Protein coding transcript 25569

• Transcript: Ll_transcript_521758
• CDS coordinates: 66-734 (+)
• Peptide sequence: MRSGGWYYKDRLGRTRGPCELIQLKTAWGAGIVDKNTFIWGEDMDEWAPIHMIYGMERAIATWEVRLGAAATALLFKLQKGIPPWVPLKGFEKKTYKQLQEEAMESKRRDLAVLEANDGVWPGVKIPSYALFLWASGTELTTILEQDQINHMPNKYIPRDLRKKLAEIIPGLRPWEVLSMEQAMDQITFNGEWYREPLGSYTTGPPYIQHWNEDVLRLYKIYE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_521758

• Blastp: Protein TIC 56, chloroplastic from Arabidopsis with 75.44% of identity
• Blastx: Protein TIC 56, chloroplastic from Arabidopsis with 75.44% of identity
• Eggnog: NA(ENOG4111F7B)
• Kegg: Link to kegg annotations (AT5G01590)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446533.1)
• Pfam: Domain of unknown function (DUF4339) (PF14237.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;