Protein coding transcript 2557

• Transcript: Ll_transcript_281083
• CDS coordinates: 79-867 (+)
• Peptide sequence: MPKKMGVNTKAEAARARKGSLEAERKEKASREKEEQYWRDAEGSKSRASKKKEEEAEKRAEAAARKAEARRLAELEEKELEKSMMKKKANRVSIPVTKVTEAELRRRREEEESEMKRKAEEGKKKQSRTAEEEEYERMVVVANRNRDDSIIEASSVDEAIAQITINTSDFPPDRHPERRLKASFKAFEEAELPVLKEEKPGLTHTQYKDLIWKLWKKSPDNPLNQVCYLTHFSIHYYLIQYYYYFTSITYLPYSLPQIAKTD*
• ORF Type: complete

Annotations of Ll_transcript_281083

• Blastp: Coiled-coil domain-containing protein 124-A from Xenopus with 38.82% of identity
• Blastx: Coiled-coil domain-containing protein 124 homolog from Dictyostelium with 48.72% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (447348)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416815.1)
• Pfam: Coiled-coil domain-containing protein 124 (PF06244.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;