Transcript | Ll_transcript_49476 |
---|---|
CDS coordinates | 1095-1508 (+) |
Peptide sequence | MHMIFSLCSDEGVVAAEPAAAPASVIPGEPMDILTALQLVLRKSLAYGGLARGLHEAAKVIEKHAAQLVVLAEDCDQPDYVKLVKALCAEHNVSLLTVPSAKTLGEWAGVSIIDSKPYLLFLIGSFEYLVSKYVGQH* |
ORF Type | complete |
Blastp | 40S ribosomal protein S12 from Hordeum with 65.52% of identity |
---|---|
Blastx | 40S ribosomal protein S12 from Hordeum with 68.87% of identity |
Eggnog | (ribosomal) protein(COG1358) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019455434.1) |
Pfam | Ribosomal protein L7Ae/L30e/S12e/Gadd45 family (PF01248.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer