Protein coding transcript 255763

• Transcript: Ll_transcript_49463
• CDS coordinates: 120-461 (+)
• Peptide sequence: MSGEEGVVVPEPVAAASIPGEPMDILTALQLVLRKSLAYGGLARGLHEAAKVIEKHAAQLCVLAEDCDQPDYVKLVKALCAEHNVSLLTVPSAKTLGEWAGVSFINSKPYYFT*
• ORF Type: complete

Annotations of Ll_transcript_49463

• Blastp: 40S ribosomal protein S12 from Hordeum with 72.12% of identity
• Blastx: 40S ribosomal protein S12 from Hordeum with 78.02% of identity
• Eggnog: (ribosomal) protein(COG1358)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451829.1)
• Pfam: Ribosomal protein L7Ae/L30e/S12e/Gadd45 family (PF01248.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;