Protein coding transcript 255769

• Transcript: Ll_transcript_49478
• CDS coordinates: 3-383 (+)
• Peptide sequence: PYLNDSRKLSRIMDPRLEGQYSEIGAKKAAALAYLCLSHRPRSRPTMTTVVKTLEPLQDFDDIPIGPFVYTVPSDNGEGNKDAKESDTPKEKKRESGGHNHHHRSHHRNNGHRHHPLKSPKTPNSMS
• ORF Type: internal

Annotations of Ll_transcript_49478

• Blastp: Serine/threonine-protein kinase RIPK from Arabidopsis with 59.34% of identity
• Blastx: Serine/threonine-protein kinase RIPK from Arabidopsis with 65.91% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT2G05940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443323.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;