Protein coding transcript 25577

• Transcript: Ll_transcript_521732
• CDS coordinates: 188-1276 (+)
• Peptide sequence: MCIIVKTLTSHLTSHTYTLSLSLSLSLSLSLSLSLLLLLAMASINNFNPFGGNWFQKPPNPIPPLNTNIFSLSDHQTPNFAAISLRNLFRRKPKLPDDEPGPMEQMVYQFFEECENPPDYRHTPEVEKILNEDPIWEKRENPTEEEIRENEEMIEMIKNSPVVQFLQRAEEIADKINEMELKENERPYHKEDWEVWKNVPNVIGLDGRPMPRKAQKSRKEADDKFWDFARQFFFGLWGFRQRPYPAGRPIDVAQSIGYKNLEKRYYDFIMRSGGWYYKDRLGRTRGPCELIQLKTAWGAGIVDKNTFIWGEDMDEWAPIHMIYGMERAIATWEGFLSSILLFSLCIEQLKLIQSKKFPNVLK*
• ORF Type: complete

Annotations of Ll_transcript_521732

• Blastp: Protein TIC 56, chloroplastic from Arabidopsis with 63.49% of identity
• Blastx: Protein TIC 56, chloroplastic from Arabidopsis with 65.22% of identity
• Eggnog: NA(ENOG4111F7B)
• Kegg: Link to kegg annotations (AT5G01590)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446533.1)
• Pfam: Domain of unknown function (DUF4339) (PF14237.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;