Protein coding transcript 255796

• Transcript: Ll_transcript_49941
• CDS coordinates: 1903-2469 (+)
• Peptide sequence: MVFNIYVHLNCHLHSNYLFHKSVLYIHLLLLLQIFVSRDGGNKSFASVLAPGQHEGLGSRKRADDQGISSWGWNLNGQHSTYHALFPRAWTIYDGEPDPELKVSCRQISPFIPHDYRESSLPAAVFVYTLVNTGKERAKVSLLFTWANSIGGNSHLTGDHVNEPFIAEDGVSGVLLHHKQVIKPYSYI*
• ORF Type: complete

Annotations of Ll_transcript_49941

• Blastp: Non-lysosomal glucosylceramidase from Rattus with 45.9% of identity
• Blastx: Non-lysosomal glucosylceramidase from Rattus with 38.57% of identity
• Eggnog: Non-lysosomal glucosylceramidase that catalyzes the conversion of glucosylceramide to free glucose and ceramide (By similarity)(COG4354)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461194.1)
• Pfam: beta-glucosidase 2, glycosyl-hydrolase family 116 N-term (PF12215.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;