Protein coding transcript 255883

• Transcript: Ll_transcript_50426
• CDS coordinates: 146-733 (+)
• Peptide sequence: MPIYVKDPKLLAALQESRERHAPYAGAFLLKDEPGSDPSVVTGSETDKNVYDLKGKELFNRLHEVGTLAQISSIHGDQVILIGHRRLRITEMVSEDPLTVKVDHLKDNAFNRDDDIIKATYCEVISTLRDVLKTSSLWRDHVQTYTKHIGDFTIPRLADFGAAISGANKLQLQQVLEELDVYNRLKLTLELVKKEM
• ORF Type: 3prime_partial

Annotations of Ll_transcript_50426

• Blastp: Lon protease homolog, mitochondrial from Zea with 76.02% of identity
• Blastx: Lon protease homolog, mitochondrial from Zea with 77.36% of identity
• Eggnog: ATP-dependent serine protease that mediates the selective degradation of mutant and abnormal proteins as well as certain short-lived regulatory proteins. Required for cellular homeostasis and for survival from DNA damage and developmental changes induced by stress. Degrades polypeptides processively to yield small peptide fragments that are 5 to 10 amino acids long. Binds to DNA in a double-stranded, site-specific manner (By similarity)(COG0466)
• Kegg: Link to kegg annotations (732810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452275.1)
• Pfam: ATP-dependent protease La (LON) substrate-binding domain (PF02190.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;