Protein coding transcript 255900

• Transcript: Ll_transcript_51217
• CDS coordinates: 2114-3043 (+)
• Peptide sequence: MFSGSYQRAGCKHVSMAQIPGSSNSRSNKVCFWIFLNYLLRWYFNCNTSVFLLNAIGNLRAMRRPVGILHVKVLRAMKLKKKDLLGASDPYVKLKMSDDKMPSKKTTVKHKNLNPEWKEEFNLVVKDPESQVLEINVYDWEQVGKHDKMGMNVISLKDVPPEEPKEFTLALLKNMDSNDVQNEKSRGEVVVELTYKPFKEDELDKGFEETQAVQKAPEGTPAGGGLLVVILHEAQDVEGKYHTNPYARVTFSGEEKKTKRIKKNRDPRWDEEFQFTLEEPPTNQRLHVEVISTSSRNLLHQKVHNPYQL*
• ORF Type: complete

Annotations of Ll_transcript_51217

• Blastp: Synaptotagmin-2 from Arabidopsis with 68.31% of identity
• Blastx: Protein NRT1/ PTR FAMILY 5.6 from Arabidopsis with 65.25% of identity
• Eggnog: Domain-Containing protein(COG5038)
• Kegg: Link to kegg annotations (AT1G20080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450261.1)
• Pfam: C2 domain (PF00168.29)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;