Transcript | Ll_transcript_51231 |
---|---|
CDS coordinates | 216-752 (+) |
Peptide sequence | MSWFLPSLRPCDNPNMCTKPRKIHEVVFFLAIYLISVGTGGHKPSLESFGADQFDDNHEEERRQKMSFFNWWSCSLCSGLIVGVTLIVYIQDNINWGVADIIFTGVMAFSLLIFIVGRPFYRYLAPLGSPLTPMLHVLVAAISKRNLPYPSDSAQLYEVPESHCSNGRFMCHTNKIKY* |
ORF Type | complete |
Blastp | Protein NRT1/ PTR FAMILY 5.6 from Arabidopsis with 64.04% of identity |
---|---|
Blastx | Protein NRT1/ PTR FAMILY 5.6 from Arabidopsis with 63.83% of identity |
Eggnog | transporter(COG3104) |
Kegg | Link to kegg annotations (AT2G37900) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019450261.1) |
Pfam | POT family (PF00854.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer