| Transcript | Ll_transcript_51234 |
|---|---|
| CDS coordinates | 113-520 (+) |
| Peptide sequence | MEKINLEIKAEEAHNVEMKWVHDSSVDYKGSVPLRASTGSWKASIFIVAIEFSERLSYFGIATSLVLYLTKVMHQDLKTAARNVNYWSGVTTLMPLLGGFIADAYLGRYSTVFASCIVYLMVIMLYYFTIIIPLI* |
| ORF Type | complete |
| Blastp | Protein NRT1/ PTR FAMILY 5.7 from Arabidopsis with 57.89% of identity |
|---|---|
| Blastx | Protein NRT1/ PTR FAMILY 5.7 from Arabidopsis with 60% of identity |
| Eggnog | transporter(COG3104) |
| Kegg | Link to kegg annotations (AT3G53960) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019450261.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer