Protein coding transcript 255919

• Transcript: Ll_transcript_51205
• CDS coordinates: 273-809 (+)
• Peptide sequence: MAWFLPSLRPCDNPNMCTKPRKIHEVVFFLAIYLISVGTGGHKPSLESFGADQFDDNHEEERRQKMSFFNWWSCSLCSGLIVGVTLIVYIQDNINWGVADIIFTGVMAFSLLIFIVGRPFYRYLAPLGSPLTPMLHVLVAAISKRNLPYPSDSAQLYEVPESHCSNGRFMCHTNKIKY*
• ORF Type: complete

Annotations of Ll_transcript_51205

• Blastp: Protein NRT1/ PTR FAMILY 5.6 from Arabidopsis with 63.48% of identity
• Blastx: Protein NRT1/ PTR FAMILY 5.6 from Arabidopsis with 63.64% of identity
• Eggnog: transporter(COG3104)
• Kegg: Link to kegg annotations (AT2G37900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450261.1)
• Pfam: POT family (PF00854.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;