Protein coding transcript 255984

• Transcript: Ll_transcript_51677
• CDS coordinates: 376-879 (+)
• Peptide sequence: MSNFEGVVVSDQWLNSQFMQVELRRLKSKFVSLKDQNGKVTLGDLPHLMVKLKEFRDTYNEDEIRGILGESDDNVTNDIDFEAFLRAYLNLQNQGTEKQDGRRNSSSFLKESVTTLLHTISDSEQACYVAHINSYLGDDPFLKKFLPLDPATNDLFDLAKDGVLLWY*
• ORF Type: complete

Annotations of Ll_transcript_51677

• Blastp: Fimbrin-1 from Arabidopsis with 61.45% of identity
• Blastx: Fimbrin-1 from Arabidopsis with 81.06% of identity
• Eggnog: Microtubule associated monoxygenase, calponin and LIM domain containing(COG5069)
• Kegg: Link to kegg annotations (AT4G26700)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462393.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;