Protein coding transcript 255993

• Transcript: Ll_transcript_51688
• CDS coordinates: 1018-1983 (+)
• Peptide sequence: MSKFEGVIVSDQWLHSQFTQVELRSLKSKFVSLKNQNGKVTYGDLPPLMVKLKEFRDTYNEDEIRVILGESDANVTDDIDFEAFLRAYLNLQNQATVKQGGRRHSSSFLKDSITTLLHTISDSEQACYVAHINSYLGDDPFLSQFLPLDPATNDLFDLAKDGVLLCKLINVAVPGTIDERAINAKQNLSLWQKNDNHNLCLNSAKAIGCTVVNIGAQDLLEGRPHLVLGLISQIIKIQLLADLNLKKTPQLVELVDDSQDIEELLSLSPEKVLLKWMNFHIKRGGYQKTVKNFSSDVKVCWHFFRTFNDETMMLYIGLTSI*
• ORF Type: complete

Annotations of Ll_transcript_51688

• Blastp: Fimbrin-1 from Arabidopsis with 69.9% of identity
• Blastx: Fimbrin-1 from Arabidopsis with 69.9% of identity
• Eggnog: Microtubule associated monoxygenase, calponin and LIM domain containing(COG5069)
• Kegg: Link to kegg annotations (AT4G26700)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456581.1)
• Pfam: CAMSAP CH domain (PF11971.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;