Transcript | Ll_transcript_51694 |
---|---|
CDS coordinates | 376-879 (+) |
Peptide sequence | MSNFEGVVVSDQWLNSQFMQVELRRLKSKFVSLKDQNGKVTLGDLPHLMVKLKEFRDTYNEDEIRGILGESDDNVTNDIDFEAFLRAYLNLQNQGTEKQDGRRNSSSFLKESVTTLLHTISDSEQACYVAHINSYLGDDPFLKKFLPLDPATNDLFDLAKDGVLLWY* |
ORF Type | complete |
Blastp | Fimbrin-1 from Arabidopsis with 61.45% of identity |
---|---|
Blastx | Fimbrin-1 from Arabidopsis with 81.06% of identity |
Eggnog | Microtubule associated monoxygenase, calponin and LIM domain containing(COG5069) |
Kegg | Link to kegg annotations (AT4G26700) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462393.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer