Protein coding transcript 256015

• Transcript: Ll_transcript_52185
• CDS coordinates: 3-314 (+)
• Peptide sequence: DIVACTTIYGPSSAPEKNSTTTTTTVTTTTKSPAEVVDGDCEISHSCPKLGSFYEFFSLSHLTPPLQYIKKTVKRQVQEISNADHFFSLDVNQYFFSNFCFSI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_52185

• Blastp: Protein TSS from Arabidopsis with 32.54% of identity
• Blastx: Protein TSS from Arabidopsis with 32.54% of identity
• Eggnog: Involved in proper cytoplasmic distribution of mitochondria (By similarity)(ENOG410XQUQ)
• Kegg: Link to kegg annotations (AT4G28080)
• CantataDB: Link to cantataDB annotations (CNT0000132)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440440.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;