Transcript | Ll_transcript_52113 |
---|---|
CDS coordinates | 562-1347 (+) |
Peptide sequence | MLLKEAQLTPLPSLIAPSSLAQQPNTQEASSIQIQWPSGRTAGFLTNKLKINARDEEPSLKIGSVSAKKKSLSFSASFGTHSRHQLVDSLLSPGRKCFGTVTESSETSIVGTPSESSVKHYVDAGSTKTPMFPMKRKLSDVKDIAMLSSSGKRLNVGDQGLRSPICSSSIRKSSLQTDAVGFFTPISNLRSQQNRCTADSVDDNQYSISNPGQMIPSCQVFNELQLNNPERITLDSLVVQYLKHQHRQCPAPITTLPPLSLL |
ORF Type | 3prime_partial |
Blastp | DDB1- and CUL4-associated factor homolog 1 from Arabidopsis with 43.57% of identity |
---|---|
Blastx | DDB1- and CUL4-associated factor homolog 1 from Arabidopsis with 43.71% of identity |
Eggnog | Vpr (HIV-1) binding protein(ENOG410XR8C) |
Kegg | Link to kegg annotations (AT4G31160) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416933.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer