Transcript | Ll_transcript_49824 |
---|---|
CDS coordinates | 3580-4929 (+) |
Peptide sequence | MALNSEIKKTWKFAVITCVIDTEPMDITEALDGKNDADDSETSFAVGKSPENLKVASEKIYGAHGLGEGTPKSERSDDKFCDDIFGETPTGVRKSGKGDGLLIEKVGLHDNWDDAEGYYSYRFGEILDGRYEITAAHGKGVFSTVVQAKNLKTGNGEPEEVAIKIIRNNDTMYKAGMDELIVLKKLVGADPDDKRHCVRFLSSFKYRNHLCLVFESLNMNLREVLKKFGRNIGLRLSAVRAYAKQLFIALKHLRNCGVLHCDIKPDNMLVNEAKNVLKLCDFGNAMFAGRNEVTPYLVSRFYRAPEIILGLLYDHPLDIWSVGCCLYELYTGKVLFPGLTNNDMLRLHMELKGPFPKKMLRKGAFTEQHFDQDLNFLATEEDHVTQKTIKRMILNIKPKDIGTIITGSPGEDPKMLSNFKDLLEKTFVLDPDKRLTVSQALNHPFITGK* |
ORF Type | complete |
Blastp | Serine/threonine-protein kinase PRP4 homolog from Rattus with 54.01% of identity |
---|---|
Blastx | Serine/threonine-protein kinase PRP4 homolog from Rattus with 54.01% of identity |
Eggnog | PRP4 pre-mRNA processing factor 4 homolog B (yeast)(ENOG410XPAX) |
Kegg | Link to kegg annotations (291078) |
CantataDB | Link to cantataDB annotations (CNT0001118) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427637.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer