Protein coding transcript 2561

• Transcript: Ll_transcript_301477
• CDS coordinates: 2-340 (+)
• Peptide sequence: FTASSPPSYPARPDVGASGLGSPTVEEGEDIQTQNISIPADMVGCIIGRAGSKISEIRKSSGARISIAKAPHDETGERMFTITGGPSANEKALYLLYENLEAEKMRRSQAQD*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_301477

• Blastp: RNA-binding protein rnc1 from Schizosaccharomyces with 79.22% of identity
• Blastx: RNA-binding protein rnc1 from Schizosaccharomyces with 88.46% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPCC757.09c)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016179722.1)
• Pfam: KH domain (PF00013.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;