Transcript | Ll_transcript_50412 |
---|---|
CDS coordinates | 231-1208 (+) |
Peptide sequence | MASKSFNPSRSNLSQASDASESQKPPLPPTVRFGRRTSSGRYISYSRDSLDSELENNDFLNYTVHMPPTPDNQPMDASISQKVEEQYVSNSLFTGGFNSLTRAHLMDKVIESEANHPQMAGAKGSSCEVPGCDAKVMSDERGVDLLPCECDFKICRDCYIDAVKTGGGICPGCKESYKNTELDEVDVDNGRHLPLPLPSGVSKRDRSLSVMKPTKSLMRSQTGDFDHNRWLFETTGTYGYGNAIWPKEGNFANGKDDDDYAEPTEFMNRPWRPLTRKLKIPAAILSPYRLIIFIRIIVLVLFLSWRIQNKNVDAVWLWGMSVVCEI |
ORF Type | 3prime_partial |
Blastp | Cellulose synthase-like protein D3 from Arabidopsis with 69.88% of identity |
---|---|
Blastx | Cellulose synthase-like protein D3 from Arabidopsis with 69.88% of identity |
Eggnog | Glycosyl transferase, family 2(COG1215) |
Kegg | Link to kegg annotations (AT3G03050) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019414104.1) |
Pfam | RING/Ubox like zinc-binding domain (PF14570.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer